Exploring new features of α-amylases from different source organisms by an in silico approach
by Javad Harati; Seyed Omid Ranaei Siadat; Saeed Kaboli; Seyed Mohammad Motevalli; Ardeshir Hesampour
International Journal of Bioinformatics Research and Applications (IJBRA), Vol. 15, No. 2, 2019

Abstract: A total of 78 full-length protein sequences of α-amylase from different source organisms were subjected to phylogenetic analysis, multiple sequence alignment (MSA), motif search and physiochemical properties. The phylogenetic tree was built using the maximum likelihood method in molecular evolutionary genetics analysis (MEGA) software and was pointed out in two major clusters. One of the clusters included plants and animals, whereas the other one contained fungi, archaea and bacteria. Furthermore, Firmicutes and Proteobacteria are bacterial phylum that placed in the same evolutionary cluster with plants and animals. The deviations from expected clusters were explained by motif analysis. MSA declared three conserved sequence blocks, 505-527, 725-745 and 1010-1030, that were present in all studied species. Moreover, it provided information about highly conserved residues at which three glycine and one aspartic acid residues were conserved. Motif analysis with multiple EM for the motif elicitation server revealed that Motif 4 'HDTGSTQRHWPFPSDHVMQGYAYILTHPGIPCIFYDHFFDW', Motif 6 'EGAGGPSTAFDFTTKGILQEAVKGELWRLRDPQGKPPGMIGWWPERAVTF' and Motif 11 'EQIVKLIAIRKRNGIHSRSSIRILEAEGDLYVAMIDEK VCMKIG' were present only in plants. Pearson correlation analysis to clarify relationships among different physiochemical properties showed a direct correlation between average hydropathy (GRAVY) and the aliphatic index and a reverse correlation between GRAVY and pI and instability indexes.

Online publication date: Mon, 13-May-2019

The full text of this article is only available to individual subscribers or to users at subscribing institutions.

 
Existing subscribers:
Go to Inderscience Online Journals to access the Full Text of this article.

Pay per view:
If you are not a subscriber and you just want to read the full contents of this article, buy online access here.

Complimentary Subscribers, Editors or Members of the Editorial Board of the International Journal of Bioinformatics Research and Applications (IJBRA):
Login with your Inderscience username and password:

Username:        Password:          Forgotten your password?

Want to subscribe?
A subscription gives you complete access to all articles in the current issue, as well as to all articles in the previous three years (where applicable). See our Orders page to subscribe.

If you still need assistance, please email subs@inderscience.com